SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5F248 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5F248
Domain Number 1 Region: 117-191
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.22e-23
Family Skp1 dimerisation domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 48-108
Classification Level Classification E-value
Superfamily POZ domain 6.8e-18
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5F248
Sequence length 197
Comment (tr|A0A2G5F248|A0A2G5F248_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA62088.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_00200230v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MATKDSDNTESMEKLTLKSSEHEEGSSSNTTKDKGKAVIVEEDVKEKKLITLRTSDGIEF
VVEEGAMLLSETIKHIIEDGCADNVIPLHNVTGKYLGMIIEYCKKHYGKMSRDEEELKKW
DAEFIDLDIPTLFDLITAADYLSVKDLLELMVEKVLSMIRGRTPEQMRASFGIENDFTPE
EEEEYRSTHRWAFDDLV
Download sequence
Identical sequences A0A2G5F248
Aquca_002_00230.1|PACid:22053322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]