SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5IAA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5IAA1
Domain Number 1 Region: 19-179
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.62e-24
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00033
Further Details:      
 
Domain Number 2 Region: 376-492
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000719
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5IAA1
Sequence length 578
Comment (tr|A0A2G5IAA1|A0A2G5IAA1_CERBT) Phosphopantothenoylcysteine decarboxylase subunit SIS2 {ECO:0000313|EMBL:PIB01632.1} OX=122368 OS=Cercospora beticola (Sugarbeet leaf spot fungus). GN=CB0940_01756 OC=Cercospora.
Sequence
MPNEPDEHARLNRTVLNSTRPLNVIFASVGVADRKIVQDLIPLLADLSDVSLRAILDPAF
SSEDFFHASTSCLTMSNLARQTAARGAAEIEQEAPELCQWADLLVLAPLDANNLAKMLHG
HTDNLVLEVLRSWDVSKKILLLPGMTSPMWENPMTKKQLTKIRKKWNWVQVLQPMLWAFV
DEQKRLISWDAADELVEAVRNQVDLMNIGAGLDVSPHHKSCFTPASKQAGSMLPPELWTM
IIDYTGDWELAQTLHIYTNLKPPAEWTSHTSPQGPRNYMEALELTLLRGNLADVKHFVAT
HSVPRWLSKLCIKLIMRFAMTDLLVHLETNHTDLFWATFGHTFLPDKASSVFGRTEILEF
WRTSPSFLTKEYNCEALDGASRAGFVNILEWWQHSGLPLKFTEAALEQASSQGHISVLDW
WKAQSTAVDDSSVSVDSSKVRLKPGKSICYATQNGHTEVVRWWLYSGIAFPHEDTVSKLA
STHGHVEILQLWHEVKGSKMIFDNQVLVGATKSGNVDVLEWWKTSGLKVEYKTCDVEEAL
EDGYEGERGMEVRRWWARNGLNLGVGTSEWMKTKVLNS
Download sequence
Identical sequences A0A2G5IAA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]