SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5SJD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5SJD1
Domain Number 1 Region: 72-114
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000188
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 
Domain Number 2 Region: 143-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000451
Family Motor proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G5SJD1
Sequence length 247
Comment (tr|A0A2G5SJD1|A0A2G5SJD1_9PELO) Uncharacterized protein {ECO:0000313|EMBL:PIC15158.1} KW=Complete proteome OX=1611254 OS=Caenorhabditis nigoni. GN=B9Z55_022242 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MESDEKELAGRNGKEPRSCESESNISCRYISLIEAQRLSAQTALFFVRYLTRHPYFIAFT
LNLYSEPMDPRNKCFVPHDLRPILEALAREVLRTQPADVAEFGHMFFDEYLKHRRENRNI
LKDPAAYEVFRADLQKKFYEMERPASPMDSAATKIQAAFKGHLVRAHPEKYGMSARTTSS
EKLDSADNKKDQKRHSVGGYSIEMDTPEDRAATKIQSEIRGFLTRKHVDKMKKEDTEAAT
KIQAHIR
Download sequence
Identical sequences A0A2G5SJD1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]