SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5UK76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5UK76
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000235
Family BTB/POZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 156-198
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000759
Family Skp1 dimerisation domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5UK76
Sequence length 223
Comment (tr|A0A2G5UK76|A0A2G5UK76_9PELO) Uncharacterized protein {ECO:0000313|EMBL:PIC39751.1} KW=Complete proteome OX=1611254 OS=Caenorhabditis nigoni. GN=B9Z55_011342 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MTKKVYIEGIFKNHLLLWTKCHFGRDHLIHHHDAAPVHTPKRIQQWLEAYLPGGTNDQHL
NFSAFIIADQAAPAAQPAPAAAPKPEPSFYFNLESCDKEIVQISDLAVPQMITIHNLVSG
LGYDAEKAAKDVLPIDNVTGATLKRAVAWCEHHRGELLRYCCKKIAMMAQGKTPDELRVI
FEIPTDEEDAIAEKELKERLEREAKEEAERGIVEGPSTSTGKR
Download sequence
Identical sequences A0A2G5UK76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]