SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G7FG51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G7FG51
Domain Number 1 Region: 68-235
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.4e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00038
Further Details:      
 
Domain Number 2 Region: 378-389,432-544
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000275
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G7FG51
Sequence length 627
Comment (tr|A0A2G7FG51|A0A2G7FG51_9EURO) Phosphopentothenoylcysteine decarboxylase {ECO:0000313|EMBL:PIG79543.1} OX=656916 OS=Aspergillus arachidicola. GN=AARAC_000392 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MTVDLRADHSFSAVSRTVANAPWPTEMEVDGGGEKVIENKERSTITSHELPNNDVASPVR
RRKRLLLSTESAFVDNVLSSLVQHPDIELRLITDEPSALLSGANKVPHYMDTVDSQTFEK
KTGARRWLKAKAAELCEWADMLLVAPIDAGTLGSMLYGLTNTLTLALLRGWISSKPVVLI
PGMTVSEWHHPLNARQLQEVDRHWPWVSVITPVLMKSNNPEELVQLPWGGLEELHETIET
TLGLSFSQSSTEPIQSSEVSKVSSGKQASLNTTATTSRHPPHRSDKGARSLPMELWLNIF
EDHLRDWEIAKAVGIPTNLSVPKEWQSHLLKMSAPASLEYTILRGSFAAIKKRIDSLPRW
KPISDLACHLIFKFSRTDILSYLTENHLDLLWTTSRLTNLPYRASAIYGNPNILTWWRDA
PALPTKEYIADAMDGASRAGFVNVLEWWRTSGLELRYTERALESASAEGRVSVLDWWKKA
SANAPPSNPIPLKVGKSVLLAAQSGRAASLAWWDASGIPYSHAESVARIASTHGHVHVLD
FWYRLKGAKMIFDSQVLVGPTKNGHDNVLEWWRQSGLRVEFKTCDIEEALEDADPVSGAE
ERVRRWWARNGLNLGVGTSEWMKTKVL
Download sequence
Identical sequences A0A2G7FG51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]