SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G7UUS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G7UUS7
Domain Number 1 Region: 259-419
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.89e-33
Family Histidine kinase 0.011
Further Details:      
 
Weak hits

Sequence:  A0A2G7UUS7
Domain Number - Region: 192-270
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000785
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number - Region: 96-147
Classification Level Classification E-value
Superfamily TM1646-like 0.0392
Family TM1646-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G7UUS7
Sequence length 424
Comment (tr|A0A2G7UUS7|A0A2G7UUS7_9GAMM) Histidine kinase {ECO:0000313|EMBL:PII55487.1} OX=1914907 OS=Serratia sp. OLBL1. GN=BMF92_20015 OC=Yersiniaceae; Serratia.
Sequence
MSKKLIGTLIALVAIFSLLILLIAINFGGVKERYKQIEPNLDNYSVAEILFLAFERTKTA
LLLSENDDYDAFLIKKKIFYSKIQILESRSTFSDSFYYDDEFIKNVALLKQQYRTLGDLS
VGLLAGRKSKADILAYMDDIEGTLVDIQEIIYRIQIKNFTEVKGIIQDNSRKAEMFAVLS
LILVFLMMFLVVRNAFSLKEIIKNKNIFISSIYHEIAGSTQAIVIAADIMEHELAQEELK
KEARLISYHGNKIAEQTREVMDYSRFEMGEVNVNISTFRLHEVVDDAMTSISAGRGNRIV
VRRSSYVGLICSDKYKLYRILANLLSNADKFTHHGAIILNVKVCHGNLYLWVKDNGIGFN
VNNLERLYKAFNQGVERETRQGLGLGLTIIKNYVTTLKGAIRVKSTEGVGSSFFIRIPVK
LIKE
Download sequence
Identical sequences A0A2G7UEY8 A0A2G7UGV6 A0A2G7UUS7 A0A2G7V6Z2 A0A2G7VYH9 A0A2G7VYN8 A0A2G7W1Y6 A0A2G7XAQ3 A0A2G8A6U7 A0A2G8B3A9 A0A2G8BZD8 A0A2G8E3U1 A0A2G8EJ16 A0A2K2IPK9
WP_033644360.1.11966 WP_033644360.1.12767 WP_033644360.1.16816 WP_033644360.1.45018 WP_033644360.1.56175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]