SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8K599 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8K599
Domain Number 1 Region: 8-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000112
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 
Domain Number 2 Region: 121-144,172-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000292
Family Motor proteins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G8K599
Sequence length 202
Comment (tr|A0A2G8K599|A0A2G8K599_STIJA) Putative sperm surface protein Sp17-like {ECO:0000313|EMBL:PIK43123.1} KW=Complete proteome OX=307972 OS=Stichopus japonicus (Sea cucumber). GN=BSL78_20025 OC=Apostichopus.
Sequence
MAVPFSNTKLRVPRGFQNLLEGLAKEVLRNQPDNINAFAAIYFDNLLKIRAEQGIDPAEI
GAKHEDRFYNNKAFSKAGNMGDVSDPQQQQAATTIQAAVRGQQVREEAKEDTPVEDAAKE
DEAATRIQAAYRGYEARKRVNLLKDEDDDGKERTEAQAEEEEEIDIDLNDPEVEKAATKI
QASFRGFQTRKTMKDKDVSSFN
Download sequence
Identical sequences A0A2G8K599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]