SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8L767 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8L767
Domain Number 1 Region: 531-792
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.09e-50
Family Ankyrin repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 956-1230
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-37
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 239-259,403-560
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-22
Family Ankyrin repeat 0.003
Further Details:      
 
Domain Number 4 Region: 945-945
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000405
Family Pseudo ankyrin repeat 0.13
Further Details:      
 
Domain Number 5 Region: 766-873
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000442
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G8L767
Sequence length 1264
Comment (tr|A0A2G8L767|A0A2G8L767_STIJA) Putative poly(ADP-ribose) polymerase pme-5 isoform X2 {ECO:0000313|EMBL:PIK56117.1} KW=Complete proteome OX=307972 OS=Stichopus japonicus (Sea cucumber). GN=BSL78_07013 OC=Apostichopus.
Sequence
MKRKSSSAVPTVPAKQRKTGKGTAAKKSPVKTPKKAAPKTKKVYYTTDLQVLVCKFQSSS
TNQENSSSITAPHPKEATSKESCKKKPVPRKKTQNKKKASPKKKGAKNAPPKKKGGVKNA
SPKKKNASPKKKNPTKKGQTGSKKATSTAKGAQKDGKKKPAVHPNDKLTPNLAIEIAKKD
LMFEEKNGAGALELSGLGKAKTAIQAVLTNNMPLLQKLIKNTKEVPTLFMRRSVDIADDA
LCTAMKMKNKAAVQLLLKELEDIQHGKARMTLGRPSLQKENTGRYNYRSLGHAVRAINVA
RGGREGNDAFTKDFQSYYMRPHIGTYSAMAAQIVDNISALQPFMQSTQFGDQFKNDLFNR
IWQFARSGSYKVTGALVKLAVESDGFGFNKLHQEVLTCSKPEELTRFRSVSVKKKPYDNQ
KITPLHLSAINPNPNMMLSLLAVVPEFYITDKNGYGLIHYAAACEGSGPLEALVSRGVFP
NQATTMGLTPLMIASQLGRIQNMIFLLKPRKSIPLPGVMKEVRFVDSVMGSKTALHFAAS
NGQAEACKLLISNGANIEAITSAATNKLSPIMMASRSGHFKVVKTLVEAKASIDGKDKLK
RTPLTHAVMNGHYIIASYLLRKGADPNSKDTSGNTPTHYAAGYGWWHCVKLLIKAGADPN
IMNDWKVPSLCIAFLKGHSDCADVLIKEAGVGVDFRDAEGWTMVMMTLSNSVNEETLKQL
KFLVEQKKADVKLQDGDGWNAMHHLASSPVNEREKDKKAKQFETIIECATILVKHGCDIS
AKTDSGETPVNIVMQQDPINTGLLQLLMNKGASISLEAGEDGENVLHLMARKVVHGDQCQ
VFDLLWKQSSKGATNPLIDLIDVQDKQGFTPLLRLAAVYCNETSGKCPSENFYLHVTALF
KRFIQKGNANINYMIADDHKLAQPSQKEKGAVIFHFIYPYCGVPTSDTNGISYKNNLLKA
FASFKPNLNIRNKNGKTPLLQALEYGAVAKEAALKLISSGADVNMSLIPPGDEKDGQEEN
EAAEEGFQSVTPVILAAKNSLFSVVETLLLRGASSSSPDNKSNLLHHLAALQSAPVEVIK
CLELVLSNGVDVNLCDGKKRTPLHYAVEALTPHSTTDVVEFLLEQGANVLAKDEEGRIPL
HYAFCKLQNLDDYTQLDPIEVVTILTTAMKGRGIDMADKHGRTPLHFAAYRGATISFTHL
IEYITDLDAADDIGNTPLSLAVAGGHDRLVAVQIVGLILHPHLSPTELNIMLFLIFTQPF
RCNL
Download sequence
Identical sequences A0A2G8L767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]