SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8LEL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8LEL9
Domain Number 1 Region: 269-472
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.37e-29
Family Nucleotide and nucleoside kinases 0.00033
Further Details:      
 
Domain Number 2 Region: 59-178,210-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-20
Family Nucleotide and nucleoside kinases 0.00096
Further Details:      
 
Domain Number 3 Region: 15-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000575
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 
Domain Number 4 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000314
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G8LEL9
Sequence length 483
Comment (tr|A0A2G8LEL9|A0A2G8LEL9_STIJA) Putative adenylate kinase 8-like {ECO:0000313|EMBL:PIK58709.1} KW=Complete proteome OX=307972 OS=Stichopus japonicus (Sea cucumber). GN=BSL78_04392 OC=Apostichopus.
Sequence
MDATKKPLRIPPQFGVYAEKHNLFEMFRKLIEDLLIHKPGDPLEFLQEQLKRDDNDVPAI
IIHGPTASGKTTISKMVCSSLRTAYISADNLLADDVSATAAEAKKHLQNNQPIPTDLWVK
MIQARLQLYDCVKKGWVLDGFPETREQALALQAVGITAKHYVVLEAPDTVLIERQMGKRI
DPQTKEIYHTTFDFPTNPDVESRLVEPPEGCSETSTGERLMKWHRFSKGLERCYEKYSKF
VNADQPKADIFAQVLTFLKSKPRSLAPHTPRVILLGPTGSGKGVQAALLASKYNLVNVSS
GQLVKEAVANESKMGEAMKPYVERGMLVPDNQMVKLLDERLSQVDCTSRGWVLRGFPRTR
EQAENLSSCGHEANRVFFLDVPNDSVYERLTLRSLDVVTGQRYHSLYNPPRTVEIKDRGL
QQPKDAEEEVRQRLSAFYAYAEEIADFCEDAQHVNADQDPHTVFECIESMLVNPTPKKLD
LDE
Download sequence
Identical sequences A0A2G8LEL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]