SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8P5Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2G8P5Y8
Domain Number - Region: 24-50
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.034
Family Outer membrane lipoprotein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G8P5Y8
Sequence length 87
Comment (tr|A0A2G8P5Y8|A0A2G8P5Y8_9SYNE) Uncharacterized protein {ECO:0000313|EMBL:PIK92454.1} OX=1351840 OS=Synechococcus sp. 65AY6Li. GN=SYN65AY6LI_09600 OC=Synechococcus.
Sequence
MLNESDVENVVNGLDFEPFEHLSADQLRSEIKRLNSKAGQLKMDLHDLAEGLPDGFERLP
DLAARTYALFARLHTLRQRLKTLETCR
Download sequence
Identical sequences A0A2G8P5Y8 Q2JTK3
2010219633 WP_011430665.1.8981 gi|86606489|ref|YP_475252.1| 321327.CYA_1838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]