SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8SY78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8SY78
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily RPA2825-like 1.31e-42
Family RPA2825-like 0.0000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G8SY78
Sequence length 143
Comment (tr|A0A2G8SY78|A0A2G8SY78_9BURK) Uncharacterized protein {ECO:0000313|EMBL:PIL38711.1} OX=1603353 OS=Massilia psychrophila. GN=CR103_16350 OC=Oxalobacteraceae; Massilia.
Sequence
MGILSNIFQKIFPSSHPAVAQAPTQASPPTATTTAAAPATMSTPATASAAAVATPAAPMA
EVDVESILNHMSGASSLNWRTSIVDLLKLLSLDSSLDSRKELAKELHFTGDTGDSASMNI
WLHRQVMNKLAANGGTVPADLKD
Download sequence
Identical sequences A0A2G8SY78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]