SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8YAP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8YAP6
Domain Number 1 Region: 100-136
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G8YAP6
Sequence length 163
Comment (tr|A0A2G8YAP6|A0A2G8YAP6_TOXGO) Uncharacterized protein {ECO:0000313|EMBL:PIM04335.1} OX=1074873 OS=Toxoplasma gondii COUG. GN=TGCOUG_273065 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MADASRRSSGSSWCGCSGNRSGQQETQRESCDRRVLGVSPRADETPLNTFFAKPISASDR
TVSSDDCGDVLRGGATTLTAEQQLVQRKSQVELMIENERYLRHHAELQEMLALFMTKVLE
DKPNNILKFAGEFFTQDGLKQLVEAQADEEDTYSGIDEKLEEV
Download sequence
Identical sequences A0A125YTQ3 A0A139Y621 A0A151HPG5 A0A2G8YAP6 S8F1Y5
XP_018636715.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]