SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G9TGB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G9TGB9
Domain Number 1 Region: 41-74
Classification Level Classification E-value
Superfamily CCHHC domain 0.000000000000157
Family CCHHC domain 0.00059
Further Details:      
 
Domain Number 2 Region: 87-121
Classification Level Classification E-value
Superfamily CCHHC domain 0.000000000011
Family CCHHC domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G9TGB9
Sequence length 164
Comment (tr|A0A2G9TGB9|A0A2G9TGB9_TELCI) Zinc finger, C2HC type {ECO:0000313|EMBL:PIO56562.1} OX=45464 OS=circumcincta). GN=TELCIR_22038 OC=Trichostrongylinae; Teladorsagia.
Sequence
SPPKTPVSSSLPPSGSASPSMGTPSMPSPSVNWSARREGKLACPTPGCDGSGHQTGLYTH
HRSLSGCPRRPDKSTIQMLALQQDTVLRCTTPGCTGKGHVNSNRTSHRSLSGCPIAYQQK
LSRKGVKAPPPPRMRSPHGQEESPLDLTLRNLEQQHMSPMPLMP
Download sequence
Identical sequences A0A2G9TGB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]