SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H1C8I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H1C8I1
Domain Number 1 Region: 52-91
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000011
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H1C8I1
Sequence length 157
Comment (tr|A0A2H1C8I1|A0A2H1C8I1_FASHE) Uncharacterized protein {ECO:0000313|EMBL:PIS83711.1} OX=6192 OS=Fasciola hepatica (Liver fluke). GN=D915_09213 OC=Fasciola.
Sequence
MRHLGEIYYAGSQSSNALAEQLMFLRNRTLFNCSFMISVISEDRKPIRIPPEYVQYADKH
SIFRLAQKLLKALIIDRPDDPLSYLIEYLGKNYCESSSLFILGPASSGKRTLAELLAVKL
KRVVLTADEIFKLVPEAQVSGKIEYSIKICPSTHIFV
Download sequence
Identical sequences A0A2H1C8I1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]