SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H1FL53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H1FL53
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.4e-16
Family Txnl5-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H1FL53
Sequence length 128
Comment (tr|A0A2H1FL53|A0A2H1FL53_ZYMTR) Uncharacterized protein {ECO:0000313|EMBL:SMR42053.1} OX=1276532 OS=Zymoseptoria tritici ST99CH_1E4. GN=ZT1E4_G831 OC=Zymoseptoria.
Sequence
MPIITDFTLPTSPASLETPKDTLFLAFIASNEPSTGQSWCPDVRAALPVLQKEFSSADSQ
DLAFVEVGQRPEWRDPMNVFRQKWVVSSVPTLVKFEKENGGLREVGRLVEGEILDQQKLK
ALIDGDSA
Download sequence
Identical sequences A0A1X7RE65 A0A1Y6L818 A0A2H1FL53 A0A2H1FSL0 F9X0Y5
jgi|Mycgr1|52081|e_gw.1.1809.1 XP_003856200.1.87952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]