SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H2HWG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H2HWG8
Domain Number 1 Region: 7-75
Classification Level Classification E-value
Superfamily POZ domain 4.19e-16
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 84-142
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000000000379
Family Skp1 dimerisation domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H2HWG8
Sequence length 154
Comment (tr|A0A2H2HWG8|A0A2H2HWG8_CAEJA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:CJA01575} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MEESVIFYRLRSLDGQFFYADRQTLRMINRIESLFENAGLDHLPAHIVRPIQLEISATVM
RKVIEWCNHHKNDEPAEEEEDDDDEELAEWDAEFFMVRHSLLFDMIRAARDYGIPRLFEM
CCRVVGRNPNQIMAGLLDDDDEQREEPVVFVSAA
Download sequence
Identical sequences A0A2H2HWG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]