SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3AA87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3AA87
Domain Number 1 Region: 3-333
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 8.63e-136
Family Clathrin heavy-chain terminal domain 0.00000000421
Further Details:      
 
Domain Number 2 Region: 1191-1525
Classification Level Classification E-value
Superfamily ARM repeat 8.63e-113
Family Clathrin heavy chain proximal leg segment 0.00000000527
Further Details:      
 
Domain Number 3 Region: 447-786
Classification Level Classification E-value
Superfamily ARM repeat 2.3e-95
Family Clathrin heavy-chain linker domain 0.0037
Further Details:      
 
Domain Number 4 Region: 335-490
Classification Level Classification E-value
Superfamily ARM repeat 2.47e-58
Family Clathrin heavy-chain linker domain 0.00000375
Further Details:      
 
Domain Number 5 Region: 895-1097
Classification Level Classification E-value
Superfamily ARM repeat 1.44e-46
Family Clathrin heavy-chain linker domain 0.051
Further Details:      
 
Domain Number 6 Region: 1089-1227
Classification Level Classification E-value
Superfamily ARM repeat 0.000000015
Family Clathrin heavy chain proximal leg segment 0.011
Further Details:      
 
Domain Number 7 Region: 793-896
Classification Level Classification E-value
Superfamily ARM repeat 0.000000437
Family Clathrin heavy chain proximal leg segment 0.028
Further Details:      
 
Weak hits

Sequence:  A0A2H3AA87
Domain Number - Region: 1481-1581
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0301
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3AA87
Sequence length 1680
Comment (tr|A0A2H3AA87|A0A2H3AA87_9HYPO) Clathrin heavy chain {ECO:0000256|PIRNR:PIRNR002290} KW=Complete proteome; Reference proteome OX=858221 OS=Trichoderma parareesei. GN=A9Z42_0003450 OC=Trichoderma.
Sequence
MAPLPIKFQELVQLSSLGVDTQSIGFNSCTLESDSFVCIREKKNEAAQPEVVIVELKNGN
HVTRRPIKADSAIMHWNKQIIALKAQSRTLQIFDLEQKKKLKSCTMNEDVQFWKWISEST
LGLITTSSVYHWDVYDASQDAPVKVFERNANLNGCQIINYRVNSDGKWMVVVGISSVQGR
VVGAMQLYSKDRGISQAIEGHAAGFGTLRLDGAPQDTKIFSFAVRSATGAKLHIVEVDHP
DSNPVFQKKAVDIFFPPEATNDFPVALQVSQKYGVIFMVTKYGFIHLYDLETGSSIFINR
ISSETIFTSCADDASSGLVGINRKGQVLFVTIDDATIIPYLLENPANTEIAIKLASRAGL
PGADNLYAKQFDQLFNSGNYLEAAKIAAGSPRGFLRTPETIEKFKRLPTQPGQMAVTLQY
FGMLLDKGSLNMHETLELAQPVLQQNRKHLLEKWFKEGKLDCSEQLGDMIRPYDVNLALS
VYLQAGVHHKVVAGFAETGQFDKILPYAAQSGYQPDYLQLLQHIIRTNPDKGTEFATALA
NHEGGPLIDLERVCDIFQSQGMVQQATAFLLDALKENKPEHARLQTRLLEMNLMHAPQVA
EAILGNDMFTHFDKGRIAQLCEQAGLAQKALELYEDPEAIKRVIVNIPGTPNFNPEWLSN
FFGKLSVEQSLDCLDAMMKHNIRQNLQSVVNIATKYSELLGAVRLIDLFEKYKTAEGLFY
YLGSIVNLSEDPDVHFKYIEAATKMGQFNEVERICRDSTHYNPEKVKNFLKEAKLPEQLP
LIIVCDRFNFVHDLILFLYQNQQFQAIEAYVQRVNPSRTPAVIGGLLDVDCDEKIIRDLL
STVDAHQINIDQLVSEVESRNRLKLLLPFLEATLQAGNQQQAVYNALAKIYIDSNNNPEK
FLKENDQYDTLVVGKYCEKRDPNLAYIAYSKGQNDLELVNITNENSMYRAQARYLLERED
PELWRFVLSENNIHRRSVVDQVTATAVPESTDPAKVSVAVSCFLENDLPLELIELLEKIV
LEPSPFSDNQNLQNLLMFTAAKADKARVMDYIHKLDNYNADEIATACIDVGLFEEAFEIY
KKADNKTAAVNVLIEHVVSIDRAQAYAEDVDLPEVWSKVAKAQLDGLRVSDAIESYIKAD
DPSNYAEVIEIATHAGKNEELVRYLRMARKTLREPVIDTALAFCYARLEQLSELEDFLRA
TNVANIEESGDKAYEEGLYEASKIFYTSISNWAKLATTLVHLGDYQAAVECARKANNIKV
WKQVHEACVSKKEFRLAQICGLNLIVDAEQLQELVKDYEKNGYFDELISLLEQGLGLERA
HMGMFTELGIALSKYHPERLMEHLKIFWSRVNMPKMIRACEEANLWPELVFCYYHYDEFD
NAALTVIERPENSWDHQQFKEIVVKVANLEIYYRAIRFYVEQHPSLLTDLLAALTPRVDV
NRVVKMFQKNDSLPLIKPFLLNVQSQNKRIVNEAVNDLLIEEEDYKTLRDSVQNYDNYDA
MELAARLEKHDLIFFRQIAASIYRKNKRWEKSIALSKQDKLYKDAIETAAISAKTDIVEE
LIRYFVDIGHRECYTGMLYACYDLIRPDLVLELSWRNGLNDFTMPYMINLLAQQTKEISL
LKADNEARKAKEKDHEKVEDNTPILGGARLMITAGPGGGVSPAPYGQANGFAPQPTGYNY
Download sequence
Identical sequences A0A024S2G8 A0A2H3AA87 G0RRG4
XP_006967889.1.9351 jgi|Trire2|123228|estExt_fgenesh5_pg.C_190078 51453.JGI123228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]