SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3FBL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3FBL9
Domain Number 1 Region: 10-118
Classification Level Classification E-value
Superfamily PWI domain 7.85e-40
Family PWI domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3FBL9
Sequence length 180
Comment (tr|A0A2H3FBL9|A0A2H3FBL9_9HELO) Uncharacterized protein {ECO:0000313|EMBL:PBP22879.1} KW=Complete proteome; Reference proteome OX=946125 OS=Diplocarpon rosae. GN=BUE80_DR006262 OC=Helotiales; Dermateaceae; Diplocarpon.
Sequence
MASSVDAKLLKATKFPPEFSQKVDMQKVNAEVMKKWIAGRISEILGNEDDVVIELCFNLI
EGVRFPDIKRMQIQLTGFLDKDTAAFCKDLWKLCLSAQANPQGVPKELLEAKKLELIQEK
RKHVCAEKKSKGGNVIQIIFATASEANEGTEEVIDLIEDAVLDGETHGEEAAAKEISTEG
Download sequence
Identical sequences A0A2H3FBL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]