SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3FHJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3FHJ2
Domain Number 1 Region: 253-468
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 9.68e-42
Family Pseudo ankyrin repeat 0.056
Further Details:      
 
Domain Number 2 Region: 139-226,316-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000612
Family Ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3FHJ2
Sequence length 599
Comment (tr|A0A2H3FHJ2|A0A2H3FHJ2_GIBZA) Uncharacterized protein {ECO:0000313|EMBL:PCD19547.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_05296 OC=Fusarium.
Sequence
MSSSDSDADFDNERLSSLSHNFGASASRNNPLFIPELCYRIVELLGEKTDEHPEYRNKRS
LANLAATCKYFTATLETVLYTQDIKDGELRGLKSIVFCEEDHIALGRLEKYPEELLKPYV
DNVFNSIIDRDTPDGVVSDSCDYTMLHIAAHKLMYDTIEKLNELGATWTYVRNFQAILSY
DELVKFSSSYPAFQSIFSNINWAPNLVCLIKKDNYTCKILANFWEESYPFVGQSAFPAGL
LPVGAEDRMTLLHLHLLAVPKHIGADRAEKAIEEYPELINSPTGESQCSVYHIAVMAHSN
FALSNLLVRKLNDEVPNFVDNRGCNPLHTAFKTSLQGSRGRTPKAQTGTTDALSTLLGWN
MNPMMPHTMAPYQHPLLVMGEHAMVDWNGQNRVIKKNINDIAESEKRWAEAWGFGPVVFT
INRCDSNGNTLLGYITRAIVHYHVESGSKPLEDLFSKIVKEYGADINLDVNSFRTPMPRP
YIHSIRWMADHAIGRRRFKKLVNDLGGQLHPAEVAGTEAPALADVDFPPDQPHARCLPAD
HPYALKKPFHLAFIRKSASQRAEKRAETLQQHAIMVGFLVRDGHTQEEAVVKANQVLKL
Download sequence
Identical sequences A0A2H3FHJ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]