SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3FQ87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3FQ87
Domain Number 1 Region: 68-130
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000209
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3FQ87
Sequence length 223
Comment (tr|A0A2H3FQ87|A0A2H3FQ87_GIBZA) Uncharacterized protein {ECO:0000313|EMBL:PCD21731.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_11548 OC=Fusarium.
Sequence
MESFTQSTTPLPKLLTMPPEILFAILDLTETFQSKISLARTCIPLYNTLITEIYKQASKS
PSLAGAHIYEACRDGNILTLERIFQAETHSIDHRAQERFNRPLYTAIQFYQVNVVQWLLA
RGADPNYVGDYDAEMPMVFDSPLQLAVHSVLMPGLPEWRIPKKWHEMGFVMPGREEWWWA
GRMIIQLLRDAGADEKSLYLVLDREHLDWIQYGLQCCRLHPVC
Download sequence
Identical sequences A0A2H3FQ87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]