SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3FXK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2H3FXK0
Domain Number - Region: 102-135
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0175
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3FXK0
Sequence length 144
Comment (tr|A0A2H3FXK0|A0A2H3FXK0_GIBZA) Uncharacterized protein {ECO:0000313|EMBL:PCD19494.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_05243 OC=Fusarium.
Sequence
MADGTPKNDSVAETPQITTSADASTNGLPAQTEALQKDVVMSDAPADQPASSPAPVAHAP
SPAPARTGTPAQGSRAASAHPDAGLTIPAEAIPHGDSARRYLNTKVTGVLLEGMKQLAKD
QPSDPLRVLGEYLIQKSKELEGTG
Download sequence
Identical sequences A0A2H3FXK0 I1RSD1
FGSG_07047T0 5518.FG07047.1 XP_011326741.1.100342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]