SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3GMX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3GMX1
Domain Number 1 Region: 14-185
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.7e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00041
Further Details:      
 
Domain Number 2 Region: 373-483
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000706
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3GMX1
Sequence length 575
Comment (tr|A0A2H3GMX1|A0A2H3GMX1_GIBZA) Uncharacterized protein {ECO:0000313|EMBL:PCD32065.1} KW=Complete proteome OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN=FGRA07_09317 OC=Fusarium.
Sequence
MTSTTSLHDMGRNRKLRLLVAATGPRDTSWAQALVVRLSKNPQIEARAIVDDVVPRLTQT
IIVMQNRGLALGAGDRADDIEFYRQQAFELVEWADLMVCVPLDADSIAKMLAGVTDTFLG
EVLRGWDIQKSIVLVPGMSTHMWSNPMTKKHLNKLHRKWNWIRVVTPILWHYEGSPNPKR
VPNWNGFNEVLGIIKNQADLLGLGRDVEVATGLGMADDAGVRVQCKLPPEIWTIILDYAG
DWELSKALGMYTNLPMPTTWSSQPRDPNDPLKVYEHELEWTVLTCNSAAICKKISQSPPE
FHDISALVIKLVIKFGLIDVLAYMEANRPDLFKAFDGTTLPTKASAYYPRVDVLDYWKQS
AWFRDRHVYDAEAVDGASRFGHVRVLDWWWRRSGLGMRYTESALEQASGNGHLLVLEWWR
DAAAQDDKVVLRPGRSLLWATQHGQADVLRWWDASGIPAAHGDSVAKVASRWGQVEVLET
WRRLKGDDKLVFDAEVLVPPTIFKHLSVLDWWRKFAHGELEGMEGRKQQVEFRTCNIEEA
LEDSIGDQSSVRRWWTQNGLNLGLRDEEWLKTRYL
Download sequence
Identical sequences A0A1C3YLZ8 A0A2H3GMX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]