SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3HQQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3HQQ2
Domain Number 1 Region: 8-174,207-325
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.62e-72
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 383-578
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000149
Family Quinohemoprotein amine dehydrogenase B chain 0.055
Further Details:      
 
Weak hits

Sequence:  A0A2H3HQQ2
Domain Number - Region: 611-721
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000798
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3HQQ2
Sequence length 1220
Comment (tr|A0A2H3HQQ2|A0A2H3HQQ2_FUSOX) Coatomer subunit alpha {ECO:0000256|PIRNR:PIRNR003354} KW=Complete proteome; Reference proteome OX=327505 OS=Fusarium oxysporum f. sp. radicis-cucumerinum. GN=AU210_004514 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MQSSPGMLTKFESKSSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLIDRFEEHDGPV
RGVDFHKTQPLFVSGGDDYKIKVWSYQTRRCLFTLNGHLDYVRTVFFHHELPWILSASDD
QTIRIWNWQNRSLICTMTGHNHYAMCAQFHPKEDLVVSASLDQSVRVWDISGLRKKHSAP
TSMSFEDQMARANQNQTDMFGNTDAVVKFVLEGHDRGVNWVAFHPTMPLIVSAGDDRLVK
LWRMSETKAWEVDTCRGHFQNASGCLFHPHQDLILSAGEDKTIRVWDLNKRTAVQSFKRE
NDRFWVIAAHPEINLFAAGHDNGVMVFKLERERPASAVHQNLLFYVTKEKHVKSYDFQKN
IESPTLLSLKKLGSAWVAPRTLSFNPAERSILVTSPADGGSYELVNLPKDGSGAIEPAES
KRGSGSSAIFVARNRFAVLNTANQTIDIKDLSNNTTRSFKPPTGTTDIYFGGTGNLLIIA
PTSVHLYDIQQKKSTAELAVNGVKYVVWSNDGLYAALLSKHNVTIVSKTLEQVSTLHETI
RIKSATWDDAGVLLYSTLNHVKYTLLNGDNGIVRTLDQTVYLVKVKGRNVYCLDRAAKPR
ILQVDPTEYRFKLALVKRNYEEMLHIIRNSSLVGQSIISYLQKKGYPEIALQFVQDPTTR
FDLAVECGNLDVAVEMAKELDKPKFWTRLSTEALAHGNHKVVEMCYQKLKQFDKLSFLYL
ATGNQSRLARMAKIAEHRGDFTSRFQNALYLGEVEDRIQMFKEIDLYPLAYMTAKSHGLE
EECQSILEATGLTEEDLTLPTLGEALSVREPVVHTFESSWPTKATSQSFFEKALLGQVEG
LSLEDEPAAANTGFEDAMEDDSAAKRNGALIDDDDEDAAGWDMGDDDVPEADSDFVNVES
VDAGGAASSEADMWARNSPLAVDHVAGGSFETAMQLLNRQVGAVDFAPLKSRFLEVYSAS
KTFLPASEGLPPLINYVRRTLDETDPRKVLPIIPRDLEHLASNDLQAGYDSMKANKLEAG
IGIFKGILHSILVNAVSSEDEVAEAKKLITSASEYAVAMSIELSRRQLGAPDIVAKDAEK
LQRSLELSAYFTIPKIEVPHRQLALLSAMQLAIRNKNYNSALSFANRIIANGGATKIVEN
AKKTKAQCERNPNDAIEIEFDQFAEFDVCAASHTPIYSGTAYEECAFDGSKYHTKYKGTV
CRVCEVCEIGKHGSGLKLFA
Download sequence
Identical sequences A0A2H3HQQ2 W9KSZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]