SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3I314 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3I314
Domain Number 1 Region: 243-305
Classification Level Classification E-value
Superfamily XPC-binding domain 1.83e-20
Family XPC-binding domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-19
Family Ubiquitin-related 0.0011
Further Details:      
 
Domain Number 3 Region: 297-362
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000148
Family UBA domain 0.0015
Further Details:      
 
Domain Number 4 Region: 121-178
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000447
Family UBA domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3I314
Sequence length 366
Comment (tr|A0A2H3I314|A0A2H3I314_9EURO) Ubiquitin supergroup {ECO:0000313|EMBL:PCG92541.1} KW=Complete proteome; Reference proteome OX=290292 OS=Penicillium occitanis. GN=PENO1_088140 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MKLTFRDLKQQKFTIEAEPSETVGQVKEKIAQEKGWEASQQKLIYSGKILQDANTIESYN
IEEKGFIPKPAAGGPSTPAKAAPAATPSAPAPAPPATTAAAPQVPSTPTPASSGATAAAG
EAPAFNDPSALAMGTQGEAVIAQMEAMGFPRADIDRAMRAAFFNPDRAVDYLLNGIPESA
EQEQAQARAAAASPPAATTPAAAAATEATGDEPVNLFEAAAQAGGAAGRGAAGGAGAGDA
GTLGNLDFLRNNPHFQQLRQLVQQQPQMLEPILQQVGAGNPQLAQLIGQNQEQFLQLLAE
DLGEEGELPPGAHEIRVTEEERDAIERLCRLGFSRDSVIQAYFACDKNEELAANFLFEQP
DEGDDQ
Download sequence
Identical sequences A0A2H3I314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]