SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3IQH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3IQH2
Domain Number 1 Region: 85-146,183-245,418-555
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-47
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 280-514
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.62e-18
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 5-50
Classification Level Classification E-value
Superfamily F-box domain 0.00000122
Family F-box domain 0.0092
Further Details:      
 
Domain Number 4 Region: 530-613
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000942
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3IQH2
Sequence length 626
Comment (tr|A0A2H3IQH2|A0A2H3IQH2_9EURO) Uncharacterized protein {ECO:0000313|EMBL:PCH01742.1} KW=Complete proteome; Reference proteome OX=290292 OS=Penicillium occitanis. GN=PENO1_041480 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MLPQTLSLLPSEILFEVCEHLSLSDLARLVRTSKFFARIGTQPLYDRLFFNSVRPKASIN
IARLRSQFILAYFGANSEKLLAAQAAKGRSILHYVAAAGNNALMNILLEKGTNISVRNHN
GETPLHTALEKGKEAMAVKLIDAGADVLGPARGRPILAYVHADISQPVVEKLISAIRAAG
GDISRCNPDGHTVLHYASRRGYDRLVGILVANGADVFAANKYGHPPLISAILQKRVGVSK
ILLSAMKSDPRGYDINEPIASLKNVPRSWIPEKISMFYDNGDTLLHSAVRTWSTATVQLL
LDFGANPLAQNNPGCIAPKTPFDIAVLGRCPELVILITRINNATAFWTSNGYIQEGFETC
VREAYPGTVRVLCDLYKEGKVHLDLAAAADQILQTCTYYGDHVRDQDVNDTVTYVVSAGA
NVNAQDARGRTPLHLLCRFSGGEYQDDAKIRLIKYLLNCGADWRIQDEEGNTVLHTAAKE
GCDSVIRYILRTISPTDRAIVGSGNRGGNTPLHYYTGSFATSDPECTSTIKLLVDSGCDP
NAVNSKGQSITHLAITQWVLIDVIKFISKLGGDMCRKDNEGRPPIHYAATLPDMEEQDRQ
KIIKYFVEEKADLHWGCRQCEHRFPE
Download sequence
Identical sequences A0A2H3IQH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]