SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3J695 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3J695
Domain Number 1 Region: 18-190
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.22e-22
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0003
Further Details:      
 
Domain Number 2 Region: 387-486
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000116
Family Pseudo ankyrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3J695
Sequence length 588
Comment (tr|A0A2H3J695|A0A2H3J695_9EURO) Flavoprotein {ECO:0000313|EMBL:PCH06854.1} KW=Complete proteome; Reference proteome OX=290292 OS=Penicillium occitanis. GN=PENO1_014800 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
METAATTKRPPENTQRRKRVLLSTESAFASNFLPPLIRSPDIELRLITDEESSAISTGAT
KVPHYMDSVDSHTFDNRTGSRRWLRAKAAELCEWADLLIVAPIDAGTLGSMLYGLTHTLT
LSLLRGWDVNKPVFLVPGMTVSEWTNPLTERQLQELEHNWPWVVRIPPLLWSHTGPEELT
QLPWDGSRVFEDLLQKMLDLTGVSDVQDASQSTPEPEEKLETKNSSMAIAKLAQQAAKHR
EESQSGRPKSLPLELWLNVFVDHLGDWEIAKAVGIPTNLPVPREWQPHILKMSTPPSLEY
TILRGSFTAITSKIKELTPYTPLSNLACHLIFKFSRTDILTYLLEKHPSLYNTTTRFKNI
PYLASAIYGNPTILTWWRDSPDSSTQEHSADAMDGASRSGHINVLDWWVSSGLPLRYSER
ALESASAEGRIDVLEWWKNACWNAPSSRPIPLKVGKSVLLAAQSGKTQSLAWWDASGIPY
THSESVARIASTHGHIHVLELWYRLKGAKMIFDNQVLVGATRSGHDNVLEWWRKSGLRVE
FKTCDIEEALEDADPSTHAAQRVRQWWARNGLNLGVGTSEWMKVKVLT
Download sequence
Identical sequences A0A2H3J695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]