SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3JD75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3JD75
Domain Number 1 Region: 228-309
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000981
Family Pseudo ankyrin repeat 0.039
Further Details:      
 
Domain Number 2 Region: 318-409
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000772
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3JD75
Sequence length 417
Comment (tr|A0A2H3JD75|A0A2H3JD75_WOLCO) Uncharacterized protein {ECO:0000313|EMBL:PCH35638.1} KW=Complete proteome; Reference proteome OX=742152 OS=Wolfiporia cocos (strain MD-104) (Brown rot fungus). GN=WOLCODRAFT_133916 OC=Agaricomycetes; Polyporales; Wolfiporia.
Sequence
MASNDDCIDQVFDAYRRFTHEQLVLFLKVRSLPVTGSDEDLACRLAQYDLHTYHLYPAMN
GLMVHGVAGPKSLPSPPEPLKSRPRQVMARDLPVEILAEIMDHVGDWELAKAVGVPTSLP
EPLEWKFASCADHAILTGYLPLVRAADPSAHPPTRIAAVLTARFCYVHVLEYLLTQHRSL
FLSMYKDDLLPITASLHGRTAVLSWWRHSQEQYPESVPLPKPASVQTAIDGASRNGQVAS
LDWWLHSGIPLEYSEAALESASAKNQLDVLAWWKQQSVGVHKLPLKIGRVMDMASNAGHV
DVLEWWARNVPEVKYDKQALYHASCHGKVDVLQWWLGSGLQLIFDQDALTGATRHNRPDV
LEWWDKSALPIQYRMCDIEEALEDAIGGGEAAREWWRRKGVDFNANDKEWMKLQNLN
Download sequence
Identical sequences A0A2H3JD75
jgi|Wolco1|133916|estExt_fgenesh1_pm.C_120062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]