SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3JIC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3JIC1
Domain Number 1 Region: 197-271,299-349
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.48e-28
Family cAMP-binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 354-489
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.59e-24
Family cAMP-binding domain 0.00011
Further Details:      
 
Domain Number 3 Region: 11-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000445
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3JIC1
Sequence length 500
Comment (tr|A0A2H3JIC1|A0A2H3JIC1_WOLCO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=742152 OS=Wolfiporia cocos (strain MD-104) (Brown rot fungus). GN=WOLCODRAFT_137312 OC=Agaricomycetes; Polyporales; Wolfiporia.
Sequence
MSFPPDTSMSTFESLIEDLTRDVSRVQPRDALQFCANWFQSRLEEQRTRTRDLLAQRPSF
ARDLPADHYLDTPLSPTSAPSHPSISPFAQTFSPKQRSSLHNSFSNLSPFGTLNVPGNAL
LSESRQMTPPPVFRVDREEVAPASPLSNAPNPFESFANGPISPPSNDYLTALDPTILARR
ASVSAESIPVDSEVDEVLPVYPKTDEQLRRIRASIAHNFIFRDLDEEQETGVLRAMREQH
VRADEVVVRQGDVGDFFYVVEQGHLNCYIRPEPLPPAWLTGVAAPSEKFLQPGYHPEFGK
KVAECREGSSFGELALMYGHPRAATVLAIESSTLWSLDRITFRTIILKAAHRRRTMYEQF
LSSVPLLKSLEAEERSKVADALVSRVYADGEAVVRQGEMGDTFFFVEEGEAVVTKAAVGA
DGTTTVNEVLRYTKGDYFGELSLLRLEPRAATVSAVTRTDPAKPKLKVAALDAHAFTRLL
GPLREIMERNAGQTYGLGRR
Download sequence
Identical sequences A0A2H3JIC1
jgi|Wolco1|137312|estExt_fgenesh1_kg.C_4_t10450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]