SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3SRR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2H3SRR6
Domain Number - Region: 52-156
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.00798
Family MW0975(SA0943)-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3SRR6
Sequence length 160
Comment (tr|A0A2H3SRR6|A0A2H3SRR6_FUSOX) Uncharacterized protein {ECO:0000313|EMBL:SCO79137.1} KW=Complete proteome; Reference proteome OX=5507 OS=Fusarium oxysporum (Fusarium vascular wilt). GN=FRV6_03350 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MDTALPLQEDGENHPSQDDIKPSVPAPEETNMSNIQKHPHASRRTPEPQVDRQANNSDPP
DTPGALEPFDWDEFEARYEAALQEADEREREILKEADALSKYFKIWAASASAHDDERAAK
RLQTRRRFVNLAEDKMERKQQHYDQVVRAFESALALLKSQ
Download sequence
Identical sequences A0A0J9U8A6 A0A2H3SRR6 W9ID70 W9Q9L6 X0BW86 X0CZD0
XP_018233464.1.49799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]