SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3TLQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3TLQ3
Domain Number 1 Region: 28-199
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.15e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00042
Further Details:      
 
Domain Number 2 Region: 387-497
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000379
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3TLQ3
Sequence length 589
Comment (tr|A0A2H3TLQ3|A0A2H3TLQ3_FUSOX) Related to SIS2 protein (Cycle-specific gene control) {ECO:0000313|EMBL:SCO85700.1} KW=Complete proteome; Reference proteome OX=5507 OS=Fusarium oxysporum (Fusarium vascular wilt). GN=FRV6_09827 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MAHHHSFSPRLSPALASTSSLHDMARNRKLRLLVAATGPRDTSWAQALVVRLSKNPQIEA
RAIVDDVVPRLTQTIIVMQNRGLAMGAGDRADDIEFYRQQAFELVEWADLMVCVPLDADS
IAKMLAGVTDTFLGEVLRGWDTQKSIVLVPGMSTHMWSNPMTKKHLSKLHRKWNWIRVVT
PILWHYEGSPNPKRVPNWNGFNEVLGIIKNQADLLGLGRDVEVATGMAMTDNADVTVQSK
LPPEIWTIILDYAGDWELAKALGMYTNLPMPSPWTSQPRDRNDPLKVYEHELEWTVLTCN
SAAICKKISQSPPEFHDISALVIKLVIKFGLIDVLAYMEANRPDLFKAFDGTTLPTKASA
YYPRTDVLDYWKQSAWFRDRHVYDAEAVDGASKFGHVRVLDWWWRRSGLMMRYTESALEQ
ASGNGHLLVLEWWRDAAAQDDKVVLRPGRSLLWATQHGQADVLRWWDASGIPAAHGDSVA
KMASRWGQVEVLETWRRLKGDDKLVFDAEVLVSPTIFKHLAVLEWWRNFAHGELEGMEGR
KQMVEFRTCNIEEALEDSIGDQSAVRRWWTQNGLNLGLRDEEWLKTRYL
Download sequence
Identical sequences A0A2H3HL06 A0A2H3TLQ3 F9FXN8 N4UE19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]