SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3YQS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3YQS6
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 1.11e-58
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000548
Further Details:      
 
Domain Number 2 Region: 278-420
Classification Level Classification E-value
Superfamily L30e-like 4.71e-52
Family ERF1/Dom34 C-terminal domain-like 0.00000599
Further Details:      
 
Domain Number 3 Region: 142-276
Classification Level Classification E-value
Superfamily Translational machinery components 1.18e-47
Family ERF1/Dom34 middle domain-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3YQS6
Sequence length 437
Comment (tr|A0A2H3YQS6|A0A2H3YQS6_PHODC) eukaryotic peptide chain release factor subunit 1-3-like {ECO:0000313|RefSeq:XP_008801034.1, ECO:0000313|RefSeq:XP_008802095.1} KW=Complete proteome; Reference proteome OX=42345 OS=Phoenix dactylifera (Date palm). GN=LOC103715243 OC=Phoeniceae; Phoenix.
Sequence
MADGHETDKNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQISRVTKMLGDEYGTASN
IKSRVNRQSVLAAITSAQQRLKLYSKVPPNGLVLYTGTIVTEDGKEKKVTIDFEPFKPIN
ASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTLSGNTREVLHKFTVDLPKKHG
RGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVAGLILAGSADFKTELSQS
DMFDPRLQAKILNVVDVSYGGENGFNQAIELSAEILSNVKFIQEKKLIGKYFEEISQDTG
KYVFGVDDTLKALEMGAVETLIVWENLDINRYVLKNSVTGEIIIKHLNKEQEADQNNFRD
PASNAELEVQDKTSLLEWFANEYKRFGCTLEFVTNKSQEGSQFCRGFGGIGGILRYQLDI
RSFDELSDDGEVDEDSD
Download sequence
Identical sequences A0A2H3YQS6
XP_008801034.1.81946 XP_008802095.1.81946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]