SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4SNT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4SNT3
Domain Number 1 Region: 7-170,203-343
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.25e-69
Family WD40-repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 316-558
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000000628
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.02
Further Details:      
 
Domain Number 3 Region: 610-708
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000589
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H4SNT3
Sequence length 850
Comment (tr|A0A2H4SNT3|A0A2H4SNT3_CORMI) Alpha subunit {ECO:0000313|EMBL:ATY64753.1} OX=73501 OS=Cordyceps militaris (Caterpillar fungus) (Clavaria militaris). GN=A9K55_005145 OC=Cordyceps.
Sequence
MSSSPNMLTKFESKSSRAKGLAFHPKRPWILVTLHSSTIQLWDYRMGTLIDRFEEHDGPV
RGVDFHKTQPLFVSGGDDYKIKVWSYQTRRCLFTLNGHLDYVRTVFFHHELPWIISSSDD
QTIRIWNWQNRSLICTMTGHNHYTMCAQFHPKEDLVVSASLDQTVRVWDISGLRKKHSAP
TSMSFENQVARSNQNQTDMFGNTDAVVKFVLEGHDRGVNWVAFHPHMPLIVSAGDDRLVK
LWRMSETKAWEVDTCRGHFQNAEGCLFHPHQDLILSTGGDKTIRVWDLNKRTAVQTFKRE
NDRFWVIAAHPEINLFAAGHDNGVMVFKLERERPASAVNQNTLFFLSKEKLVKSYDFQKN
IESPTLLSLKKLGSAWVAPRTLSYNPAERSVLVTTPADEGSYELVNLPEEGSGNVEPTES
KRGPGNSAIFVARNRFAVFNLSTQAIDIKDLSNNTTHSFKAPAGTTDIYFGGTGNLLIIT
ATAVHLYDIQQNTSTAELAVNGVKYVVWSNDGLYAALLSKHNVTIVTKTLEQVSTLHETI
RIKSATWDDAGVLLYSTLNHVKYTLLNGDNGIVRTLDQTVYLVRVKGRNVYCLDRSAKPR
ILQIDPTEYRFKLAVVKRNYEEMLHIIRNSSLVGQSIISYLQKKGYPDIALQFVQDPTTR
FDLAIECGNLDVAVEMAKELDKPKFWNRLSAEALSHGNHQIVEMCYQKLKQFDKLSFLYL
ATGDHSKLARMAKIAEHRGDFTARFHNALFLGDVEDRIQMFKEINLYPLAYMTAKSHGLD
DECQAILDATGITEEQLTMPALGKPFVPQSPLCRPSSKTGLQRPHLSHSSKRPFSDKWKI
FHSKIILMLR
Download sequence
Identical sequences A0A2H4SNT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]