SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4UT47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4UT47
Domain Number 1 Region: 139-398
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.21e-26
Family Ankyrin repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 380-462
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000144
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Domain Number 3 Region: 461-539
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000262
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H4UT47
Sequence length 540
Comment (tr|A0A2H4UT47|A0A2H4UT47_9VIRU) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:ATZ80122.1} OX=2024608 OS=Bodo saltans virus. GN=BMW23_0060 OC=unclassified Mimiviridae; Klosneuvirus.
Sequence
MYYHNYNKNLKIMLTDWIIHTKLYDNLKIEKSLDNAKLNSIIEKVIEFPFKDCLNDLIIN
EKIEILFENPKICIIFGSIELNENKITSIRNKFINFAMRNEFEFDDSYKNENGVLYDFYE
NMLKISCVGTTHKCYCSMVAASRGHLECLKCFHEKGRYWNEETCVSAVLNGHLECLKYLH
ENGCSWNIGTCSFAAEKGHLECLKYAHENGCPWDSNTCAYAAENGHLECLKYAHENGCHW
NEKICENAAKNGHLECLKYAHENGCPWNEYTCTHAAQNGHLECLKYAWKNGYIYNIDICV
FAAENGHLECLKYAHENGCHWDKRTCSAAAHNGHLECLKYAHENGCSWNEMTCINAAREG
HLDCLKYAHENGCPWNETVCINATRFGHSECLKYAHENGCPWEKNICEKIAKYGHLECLK
YAHENGCHWDKWTCAYAAGNGHLECLKYAHENGCPWDKNTCSNAAFNGHLECLKYAHENN
CSWDEYTCESAASNGQLECLKYARENGSPWGKYTYLYATRGNKNAECLKYMRENGCPINE
Download sequence
Identical sequences A0A2H4UT47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]