SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4UTB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4UTB5
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000811
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H4UTB5
Sequence length 159
Comment (tr|A0A2H4UTB5|A0A2H4UTB5_9VIRU) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:ATZ80114.1} OX=2024608 OS=Bodo saltans virus. GN=BMW23_0052 OC=unclassified Mimiviridae; Klosneuvirus.
Sequence
MASCIETKDKCENCDVAIKKQHLKCVKYIHMIKNRNSEYLNFQDENDYTWNEYICQNAVK
NDHFNCVKYLHENGCPWDKYTCASAAHNGNLECLKYLHENGCPWDKYTCLNAVRNGHFEC
LKYAHENGCPLDEDVCIYVASCNKHYKCKKYLYDLQKQK
Download sequence
Identical sequences A0A2H4UTB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]