SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4UTJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4UTJ3
Domain Number 1 Region: 102-125,190-273
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 2.22e-17
Family Pseudo ankyrin repeat 0.015
Further Details:      
 
Domain Number 2 Region: 135-217
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000108
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H4UTJ3
Sequence length 294
Comment (tr|A0A2H4UTJ3|A0A2H4UTJ3_9VIRU) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:ATZ80166.1} OX=2024608 OS=Bodo saltans virus. GN=BMW23_0106 OC=unclassified Mimiviridae; Klosneuvirus.
Sequence
MSIDWIIHTQLYANLIKEKTLDSTKLNCIIENLINFPFKDSLNELIVNEKIEILFENPKI
SEIFELIEFDEIKTKRISDKFIDFVLEKTQNKKRFGFYNSYKNENGKLYNFYKNIFKITC
FEFKNKNKCKTRYDASKRGHLGCLKYLHKKNTIDNNDPRTRQICINAAANRHLECLKYAH
ENGYPWDVQTCSQAAKNGHLECLKYAHENGCPWDEWSCRYAAENGHLECLKYAYENGYKL
DEWICAYAAKNGHLKCLKYLHENGCPWHWWTCRNAKSYGHLECFQYARDHGCPE
Download sequence
Identical sequences A0A2H4UTJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]