SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4UVK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4UVK6
Domain Number 1 Region: 162-477
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.69e-29
Family Ankyrin repeat 0.0075
Further Details:      
 
Domain Number 2 Region: 87-188
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 7.06e-18
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H4UVK6
Sequence length 481
Comment (tr|A0A2H4UVK6|A0A2H4UVK6_9VIRU) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:ATZ80952.1} OX=2024608 OS=Bodo saltans virus. GN=BMW23_0907 OC=unclassified Mimiviridae; Klosneuvirus.
Sequence
MLTDWIIHTKLYDNLKKEKSLDNVKLNDLIINEKIEILFENPKICIIFDLIEFNENKITS
IRNKFINFAIRNKLEFDDSYKNENGKLYNFYENMLKVTCFGKCKDCTHAAQNGHLECLKY
VHENGCPWDNYTCRIAALNGHLECLKYAHENGCPWGLYTCLYAAENGHLECLKYAHENGC
PWDERACSDAAKNGHLECLKYLHENGCPWNEDTCRYAAFYGQLECLKYAHENGCPWDELT
CTTVVLNEHLKCLKNGYPWNEKTCEKTCEKAVLNGHLECLKYAHENGRPWDEKTCEKAAL
NGHLECLKYAHENGCSWNEKTCEKAALNGDLECLKYAHENGCSWNSETCKYAARSGDLEC
LKYAYENGCPWDEWTCMSAAWDGDLECLKYAHENGCSWNSNTCHIAAEHGHLECLKYAHE
NGCPWDENTCLFAALNGHLECLKYAHENGCSWDERTWSYAKLNEHVECLEYLEYVHENDM
F
Download sequence
Identical sequences A0A2H4UVK6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]