SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4UW51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4UW51
Domain Number 1 Region: 79-91,148-231
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.57e-16
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H4UW51
Sequence length 252
Comment (tr|A0A2H4UW51|A0A2H4UW51_9VIRU) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:ATZ81178.1} OX=2024608 OS=Bodo saltans virus. GN=BMW23_1135 OC=unclassified Mimiviridae; Klosneuvirus.
Sequence
MLTDWIIHTKLYDNLKIEKSLDNVKLNSIIEKVIEFPFKDCLNDLIIDEKIEILFKNPKI
CIIFESIELNETKITSIHDKFINFAIRNNFEFNDLYKNENGELYDFYKNMLKITCFGKCK
DCNAAAKKGHLGCLKYAHEKGCSWDKDTCKYAAQNGHLECLKYAHENGCPWDEYTCTHAA
QNGQLKCLKYAYENVCRWDSKTCYYAAGNGQLECLKYAHENGCPWDTYTCTCAVLGGYLE
CLKYARENGCLE
Download sequence
Identical sequences A0A2H4UW51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]