SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4UWA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4UWA9
Domain Number 1 Region: 102-217
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.29e-16
Family Pseudo ankyrin repeat 0.015
Further Details:      
 
Domain Number 2 Region: 232-282
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000144
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H4UWA9
Sequence length 288
Comment (tr|A0A2H4UWA9|A0A2H4UWA9_9VIRU) Ankyrin repeat domain-containing protein {ECO:0000313|EMBL:ATZ81184.1} OX=2024608 OS=Bodo saltans virus. GN=BMW23_1141 OC=unclassified Mimiviridae; Klosneuvirus.
Sequence
MLTDWIIHTKLYDNLKIDKSLDNAKLNNIIERVIEFPFSDKLNDLIVNDKIEILFENPKI
CIIFELIELNEDKIASIRNKFINFAIRNEFEFDDSYKNENGELYDFYENMLKIACFGKCK
DCTNAASKGHLECLKYARENDCPWNYLTCIYAAQNGHLECLKYAHENGCPWDKDTCHYAA
KNGHLECLQYAHENGCPWDELTCSFAALNGNLNCLQYAHENNCSWDEDTCGNAAENGHLE
CLQYAHENDCPWNEETCGNAAYYGRLECLQYAHENGCPWYELHKNDCP
Download sequence
Identical sequences A0A2H4UWA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]