SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5QPV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5QPV6
Domain Number 1 Region: 163-265
Classification Level Classification E-value
Superfamily TAZ domain 6.93e-24
Family TAZ domain 0.00044
Further Details:      
 
Domain Number 2 Region: 16-60,88-117
Classification Level Classification E-value
Superfamily POZ domain 0.00000424
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H5QPV6
Sequence length 299
Comment (tr|A0A2H5QPV6|A0A2H5QPV6_CITUN) Uncharacterized protein {ECO:0000313|EMBL:GAY66623.1} OX=55188 OS=Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu). GN=CUMW_250250 OC=Citrus.
Sequence
MGADVVSLYHEKSYSIASPVLGNILQQSKVKNGFKYIKIPGVPHEAVYAFFRFLYSSCFE
EEDLKKFVLHLLVLSHSYLVPPLKRGGLTKENVIDVLQLARNCDAPRLSLICVRMVVKDF
KAITLTEGWKIMKRANPALEQELVESVVDEDSRKQERLRKVEERKVYLQLHEAMEALLHI
CRDGCRTIGPRDKVLKGSQVACNFPACKGLEALVRHFSNCKTRVPGGCVHCKRMWQLLEL
HSRMCNEPDLCKVPLCRHFKEKMQQQSKKDEAKWKLLVSKVISAKKALGPFSARHAGLL
Download sequence
Identical sequences A0A2H5QPV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]