SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5RR56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5RR56
Domain Number 1 Region: 202-334
Classification Level Classification E-value
Superfamily HCP-like 5.89e-36
Family HCP-like 0.00053
Further Details:      
 
Domain Number 2 Region: 100-234
Classification Level Classification E-value
Superfamily HCP-like 5.32e-27
Family HCP-like 0.00091
Further Details:      
 
Weak hits

Sequence:  A0A2H5RR56
Domain Number - Region: 32-110
Classification Level Classification E-value
Superfamily PWI domain 0.0144
Family PWI domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H5RR56
Sequence length 342
Comment (tr|A0A2H5RR56|A0A2H5RR56_RHIID) Sel1 repeat domain-containing protein {ECO:0000313|EMBL:GBC20570.1} OX=747089 OS=43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices). GN=RIR_0793500 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MSVIKIYSDNFYLSNTNNLLIENNLLNEYLQNFDKINIKEIKPTIQNIHENIFEEDLSIV
IDELINLIFKELNEGKDEGIIKRHVHNFINNYKLIPKEIYNWLLNNQYDYSNNICLLGYF
NYYGIETNIDKKKAIELYQKAAELENNIAQLYLAEMYVHGKGINKNCILAFELSKKLADK
GIPNAIDKLGYCYEEGIGIDINLQKAFELYQKAADLGNSSGINNLGWCYEEGIGTDINIP
KAFELYQKAADSENSYGLNNLGCCYDSGIGTNVNTQKAFELYLMAANLENKFAQFNLGVM
YEIGNGIEKNKNQAIYWYKKSAKQGHENAVHKLDDLLDITHV
Download sequence
Identical sequences A0A015KBE0 A0A2H5RR56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]