SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5VAD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5VAD8
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 7.19e-51
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0000434
Further Details:      
 
Domain Number 2 Region: 140-269
Classification Level Classification E-value
Superfamily Translational machinery components 8.28e-40
Family ERF1/Dom34 middle domain-like 0.00026
Further Details:      
 
Domain Number 3 Region: 271-415
Classification Level Classification E-value
Superfamily L30e-like 3.2e-32
Family ERF1/Dom34 C-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H5VAD8
Sequence length 415
Comment (tr|A0A2H5VAD8|A0A2H5VAD8_9ARCH) Translation termination factor aRF1 {ECO:0000256|HAMAP-Rule:MF_00424} OX=2035440 OS=archaeon HR04. GN=HRbin04_01043 OC=Archaea.
Sequence
MGKSDSVRLYRLKRMLNELSQKKGRGTELISLYIPQGKPIHEVIATLREEYGTASNIKSD
STRNHVLDALTKTMQRLKLYTKTPENGLVIFCGALPTNGLGSEVVKIFEIEPPKPLNIFL
YRCDDHFHTEILKDMLKEEKVIGIIAIDSSEAGIGVLEGNKVEVVDHITSGVGGKHRAGG
QSARRYERLREMELNDYFNRVAEHAKSLLIDTYNVVGLIVAGPGPTKDDFLKNGYLDYRL
QKNVLAVLDISYAGREGVREALEKAQDILQEYRLMEEKKLVRRLFEEINSSKGLALYGIQ
DVINALKSGVADIVLVNDNINRVRVEVVCKRCNAREERIVSMDKAIQVKQEMISSACSKC
SSIDYDVYEQDLIEYMDELAMNTGARVEVISSSTEDGKMLESLGQIAAILRYRLN
Download sequence
Identical sequences A0A2H5VAD8 H5SVY6 Q4LEG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]