SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H6BVH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2H6BVH9
Domain Number - Region: 8-101
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0363
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H6BVH9
Sequence length 160
Comment (tr|A0A2H6BVH9|A0A2H6BVH9_MICAE) Uncharacterized protein {ECO:0000313|EMBL:GBD54166.1} OX=449468 OS=Microcystis aeruginosa NIES-298. GN=BGM30_32590 OC=Microcystaceae; Microcystis.
Sequence
MTNLSIQDRINQELNKIFQALQQLEIFLRELSHQSNVMYQNALINSIALNLHGVYTGIER
IFEAIAKKIDQRFPTGDKWHRDLLEQMSVDIPRVRKAVITEETRLILDELRQFRHLVRSA
YSCQLDEEKVLIIPHEIVNSYQTIINDIQLFCNNLSKGET
Download sequence
Identical sequences A0A1E4QGB9 A0A2H6BVH9 L7E015
WP_002738740.1.15998 WP_002738740.1.42333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]