SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H6H160 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H6H160
Domain Number 1 Region: 5-56
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000000484
Family Preprotein translocase SecE subunit 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H6H160
Sequence length 58
Comment (tr|A0A2H6H160|A0A2H6H160_9ARCH) Preprotein translocase subunit SecE {ECO:0000313|EMBL:GBE20003.1} OX=2005741 OS=archaeon BMS3Abin17. GN=BMS3Abin17_00735 OC=Archaea.
Sequence
MTIISSTKSFFVKCRRVWHSLKKPTRKEFEQITKVSAIGILILGILGFLVSIVMKLFV
Download sequence
Identical sequences A0A2H6H160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]