SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H6NIV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H6NIV6
Domain Number 1 Region: 9-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H6NIV6
Sequence length 166
Comment (tr|A0A2H6NIV6|A0A2H6NIV6_MICLE) Sperm autoantigenic protein 17 {ECO:0000256|PIRNR:PIRNR016533} OX=129465 OS=Micrurus lemniscatus carvalhoi. GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MAIPFSNTTQRIPPGFANLLEGLAREVLRNQPDDIPTFAAKYFESLLIEREKTGYDPTEW
GAKLEDRFYNNRAFNELAPPGDGVKREKKEETTEKPKEEDQPVVDIEGTLSEEQAAIKIQ
SIFRGYKARKEVKGQEGEDEEGKEPGETDKEAGKEVASSEPDKGPQ
Download sequence
Identical sequences A0A2D4MU17 A0A2H6NIV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]