SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H9TLZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H9TLZ8
Domain Number 1 Region: 249-274,394-456
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000262
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H9TLZ8
Sequence length 605
Comment (tr|A0A2H9TLZ8|A0A2H9TLZ8_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:PJF18766.1} OX=1246581 OS=Paramicrosporidium saccamoebae. GN=PSACC_01419 OC=Eukaryota; Fungi; Cryptomycota; Paramicrosporidium.
Sequence
MLWPIPIPFLLLLVQKVNCSEISPEGVQKDQFNLEHTSSQSQLRVAPIKADDSLPALAES
VDNLTLTPRVENFSFENCLNMMVVIGRHLDLAKLEYLLRDSRMNTQNHPALINDHYRFAS
ALMAECPQLFSLEIANIFAILSPDTQREIAMNADVINRYSPDRIIGRIIKSIKNLDADTS
RIAPQMISSVEVLQYLFHAGXXXXKFSLKLKKGQREIRNIYIRWLVKHNCLSLLKALFPA
LPAFIQRFGLERRAIKSGNLDVLKWLLTSNDPTESYARLVCVAIYFEKPDIVTWMLTMFG
HLIDWNEELSDPDADPELYKIIPQLRLRDDTNWSHRAWCLFLIFDGDLRKLSEEYSPPVD
RRVLTRIANDAAVLGQVHILQWTYDQAEVLPKAEALQRACRNGHLSVLQWIRETCPNAIT
TLRTAAHDDHKIYADICSAFALQASQLDIVKWIYYNLPDNILPNVEMLLWSLKWLSEDMY
LEMLDWLESVNARDMLSMMVSNSPRYGHLRVLQRLHKRGYPIGIELAKTAAMHGKIEFLM
AMHEINPELLCDVEIYNSAAIGSNVGCYIVFEWMWKTFKILPKNIDSIDTDVLRWIADKR
EHLHK
Download sequence
Identical sequences A0A2H9TLZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]