SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0HBV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2I0HBV2
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.034
Family Trimerization domain of TRAF 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I0HBV2
Sequence length 70
Comment (tr|A0A2I0HBV2|A0A2I0HBV2_9GAMM) Protein SlyX homolog {ECO:0000256|HAMAP-Rule:MF_00715} OX=2058298 OS=Shewanella sp. 11B5. GN=CXF78_04400 OC=Shewanellaceae; Shewanella.
Sequence
MESVLQKIDDLEMKLSFQDISIEELNQEVIKLNALVARQQQQMLLMVNKLHSIEPSNMAS
SAEETPPPHY
Download sequence
Identical sequences A0A106BYE0 A0A2I0HBV2 Q07Y38
gi|114564401|ref|YP_751915.1| WP_011638679.1.15765 WP_011638679.1.45693 318167.Sfri_3240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]