SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0M5V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0M5V1
Domain Number 1 Region: 40-87
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000981
Family TNF receptor-like 0.0024
Further Details:      
 
Domain Number 2 Region: 110-168
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000158
Family TNF receptor-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0M5V1
Sequence length 298
Comment (tr|A0A2I0M5V1|A0A2I0M5V1_COLLI) Tumor necrosis factor receptor superfamily, member 6b, decoy {ECO:0000313|EMBL:PKK25053.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00008249 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
MLSCHTLGLRHLAKWMFAPLLLFLAELGSNAQPTYQWKDAVTHEKVTCQQCPPGTFVSQH
CSRDRQTVCAPCPELHYTHYWNYLEKCRYCNVICGERQVEVQPCNSTHNRVCQCQEGYYS
EMEFCIPHSECPPGFGVENLGTPFKNTQCSPCPPGFFSSSKSSTETCQQHQNCSKLNKVT
NVPGNKYHDTLCTSCRLGRSNSTQGPAPADDDCEQAMIDFVAYQNIPIRKLKRLQQILEH
SPRKQVPENRAAEQEKFRAFLTHLKEGNSEVSKGLLEALRAAKLHSIEEKVRKRFLLY
Download sequence
Identical sequences A0A2I0M5V1
XP_005499613.1.63277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]