SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0MPV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0MPV8
Domain Number 1 Region: 41-130
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 7.59e-31
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.00000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I0MPV8
Sequence length 143
Comment (tr|A0A2I0MPV8|A0A2I0MPV8_COLLI) Signal recognition particle 14kDa (Homologous Alu RNA binding protein) {ECO:0000313|EMBL:PKK31732.1} KW=Complete proteome; Reference proteome OX=8932 OS=Columba livia (Rock dove). GN=A306_00002045 OC=Coelurosauria; Aves; Neognathae; Columbiformes; Columbidae; Columba.
Sequence
MTPEKELANNLLDNTPCAVAGSDSLIVVCIQMVLGTSLFLKFLTELTRLFQKCRTSGSVF
ITLKKYDGRTKPVPRKGHVESFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL
RANMDGLKKKDKKSKNKKSKATQ
Download sequence
Identical sequences A0A2I0MPV8
XP_013222355.1.63277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]