SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0Q5Z1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0Q5Z1
Domain Number 1 Region: 133-201
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.000000000994
Family eIF-2-alpha, C-terminal domain 0.0074
Further Details:      
 
Domain Number 2 Region: 53-129
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.00000471
Family eIF2alpha middle domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2I0Q5Z1
Sequence length 218
Comment (tr|A0A2I0Q5Z1|A0A2I0Q5Z1_9EURY) Uncharacterized protein {ECO:0000313|EMBL:PKM92317.1} KW=Complete proteome OX=2013767 OS=Euryarchaeota archaeon HGW-Euryarchaeota-1. GN=CVU81_01115 OC=Archaea; Euryarchaeota.
Sequence
FLHISNVVSTENKGLETILKPDQEVVVKIFRASPTGYKVSLKDVPENITSKILKNVHQNQ
QIVRLFEIAGKNAKIANPQIFLQRLLNKYDEVTPLFEEAAENGLSVFEEEGIPSTMAKEL
TKMAQAKFKQKKVVISKRVKIESKKPNGLAIIKTLLQNIEKSDCNIVYLGGGTYLIKTQT
PDPKNAEKNLNNSLHEIRKKVDVCEIISDKLSAPTKKC
Download sequence
Identical sequences A0A2I0Q5Z1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]