SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2I0TSX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2I0TSX8
Domain Number 1 Region: 50-147
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 2.75e-28
Family Tubulin chaperone cofactor A 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2I0TSX8
Sequence length 150
Comment (tr|A0A2I0TSX8|A0A2I0TSX8_LIMLA) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} OX=1758121 OS=Limosa lapponica baueri. GN=llap_12785 OC=Limosa.
Sequence
MNSLLSCRQPSNCSRKRLLARIIINSDIFKLYYSNQARIYSIDLLHLVNQINIIPWFNCR
LAKEKVMYEKEAKQQEEKIEKMKAEACDDYGIKKQIEILQESRMMIPDCQRRLEVARADL
TQLLENEKELEEAEEYKEARSILESVKLEA
Download sequence
Identical sequences A0A2I0TSX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]